PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6023	AFP3_BRANA	--NA--	"Brassica napus"	Brassicaceae	--NA--	Signaling-peptide	"Antimicrobial; Fungicide; Plant defense; Secreted; Signal | Cysteine-rich antifungal protein 3 precursor (AFP3).Secreted."	--NA--	MAKFASIITLLFAALVVFAAFEAPTMVEAKLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC	79	"Protein inferred from homology"	8555.01	8549.06	8.15	--NA--	"FUNCTION:Possesses antifungal activity sensitive to inorganic cations (By similarity).SIMILARITY:Belongs to the plant defensin family."