PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6015	GASA1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Secreted; Signal | Gibberellin-regulated protein 1 precursor.Secreted."	--NA--	MAISKALIASLLISLLVLQLVQADVENSQKKNGYAKKIDCGSACVARCRLSRRPRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP	98	"Experimental evidence at transcript level"	10744.66	10737.33	9.4	--NA--	"FUNCTION:May function in some hormonal controlled step of fruit development.TISSUE SPECIFICITY:Expressed in flower buds and green siliques.Lower levels seen in the roots and rosettes.INDUCTION:By gibberellins.PTM:Six disulfide bonds may be present.SIMILARITY:Belongs to the GAST1 family.SEQUENCE CAUTION:Sequence=AAF87108.1; Type=Erroneous gene model prediction; "