PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6011	NLTP1_BRANA	--NA--	"Brassica napus"	Brassicaceae	--NA--	Signaling-peptide	"Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein 1 precursor (LTP 1)."	--NA--	MAGLVKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANAFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR	117	"Protein inferred from homology"	11856.95	11848.95	9.35	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.SIMILARITY:Belongs to the plant LTP family."
