PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6008	NLTP3_ORYSI	--NA--	"Oryza sativa subsp. Indica"	Poaceae	--NA--	Signaling-peptide	"Lipid-binding; Plant defense; Signal; Transport | Non-specific lipid-transfer protein 3 precursor (LTP 3)."	--NA--	MAGARRTMALVALVAVVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESKCGVSVAFPISTSVDCSKINSSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIP	121	"Experimental evidence at transcript level"	12144.98	12136.91	9.27	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. May possess an antifungal activity and protect the plant against pathogens.SIMILARITY:Belongs to the plant LTP family."