PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6006	IACX2_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Trypsin/alpha-amylase inhibitor CMX2 precursor (ITRL-2).Secreted (Potential)."	--NA--	MAFKHQLILSTAILLAVLAAASASFREQCVPGREITYESLNARREYAVRQQDMSRCKKLTREFIAGIVGRETCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKDSLL	121	"Experimental evidence at transcript level"	13889.27	13880.2	9.08	--NA--	"SIMILARITY:Belongs to the protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family."
