PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5984	PRO7_ORYSI	--NA--	"Oryza sativa subsp. Indica"	Poaceae	--NA--	Signaling-peptide	"Pyrrolidone carboxylic acid; Seed storage protein; Signal; Storage protein; Vacuole | Prolamin PPROL 14E precursor (Prolamin PPROL 4A) (Prolamin PPROL 7),(Prolamin PPROL 14).Vacuole, aleurone grain. Note=In rice prolamin accumulates as type I protein bod"	--NA--	LQLQQFGDLYFDRNLAQAQALLAFNVPSRYGIYPRYYGAPSTITTLGGVLMKIIFVFALLAIAACSASAQFDVLGQSYRQYQLQSPVLLQQQVLSPYNEFVRQQYGIAASPFLQSAAFQLRNNQVWQQLALVAQQSHYQDINIVQAIAQQ	150	"Experimental evidence at transcript level"	16869.29	16858.75	8.8	--NA--	"FUNCTION:Seed storage protein; serve as a source of nitrogen, carbon, and sulfur for the young developing seedling.MISCELLANEOUS:Lacks significant tandem repetitive sequences.SIMILARITY:Belongs to the prolamin family."