PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5983	GDB0_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"Repeat; Seed storage protein; Signal; Storage protein | Gamma-gliadin precursor (Fragment)."	--NA--	LQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIMKTLLILTILAMAITIGTANMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFIQPSLQQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQPQQPYPQQPQQPF	251	"Experimental evidence at protein level"	29053.97	29035.38	7.1	--NA--	"FUNCTION:Gliadin is the major seed storage protein in wheat.MISCELLANEOUS:The gamma-gliadins can be divided into 3 homology classes. Sequence divergence between the classes is due to single- base substitutions and to duplications or deletions within or near direct repeats.SIMILARITY:Belongs to the gliadin/glutenin family."
