PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5982	CY550_CYAPA	--NA--	"Cyanophora paradoxa"	Glaucocystaceae	--NA--	Signaling-peptide	"Cyanelle; Electron transport; Heme; Iron; Membrane; Metal-binding; Photosynthesis; Photosystem II; Plastid; Signal; Thylakoid; Transport | Cytochrome c-550 precursor (Cytochrome c550).Plastid, cyanelle thylakoid membrane; Peripheral membrane protein; Lumenal side"	--NA--	LPSQWGGGKIYYMFNKNFWTSIIIGCLFCTITYSGVNAAALDEETRTVALNSTETVVLTPEQMKNPTSYDGSEEIYDIHPSIRSADAFPKMRNLTEEDLYDIAGHILLSPKIVKRGKRLFNSTCGICHVGGITKTNPNVGLDSEALALATPPRNNIESLVDY	162	"Experimental evidence at protein level"	17863.29	17851.94	5.34	--NA--	"FUNCTION:Low-potential cytochrome c that plays a role in the oxygen-evolving complex of photosystem II (By similarity).COFACTOR:Binds 1 heme group covalently per subunit (By similarity).SUBUNIT:With psbO and psbU forms the oxygen-evolving complex of photosystem II.SIMILARITY:Belongs to the cytochrome c family. PsbV subfamily."