PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5966	IPIA_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Proteinase inhibitor I-A precursor (PI-IA) (Inhibitor of microbial,serine proteinases minor isoform).Secreted (Potential)."	--NA--	LGTPAKFAMQIIQKENPKLTNVQTILNGGPVTEDLRCNRVRLFVNVLDFIMVKFAHVVAFLLLASLIQPLTARDLEINVLQLDVSQSGCPGVTKERWPELVQTPQIG	107	"Experimental evidence at transcript level"	11879.99	11872.44	8.02	--NA--	"INDUCTION:By tobacco mosaic virus infection, wounding, UV light, salicylic acid and ethylene.SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family."