PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5939	AMP_AMARE	--NA--	"Amaranthus retroflexus"	Amaranthaceae	--NA--	Signaling-peptide	"Antibiotic; Antimicrobial; Chitin-binding; Direct protein sequencing; Fungicide; Plant defense; Signal | Antimicrobial peptide Ar-AMP precursor."	--NA--	KYCGRASTTVDHQADAAAAAATKTANNPTDAKLAGAGSPMVNMKSVALIVIVMMAFMMVDPSMGAGECVQGRCPSGMCCSQFGYCGRGP	89	"Experimental evidence at protein level"	9038.51	9032.13	8.31	--NA--	"FUNCTION:Chitin-binding protein that inhibits the growth of the fungal pathogens B.cinerea, F.culmorum, H.sativum and A.consortiale, but not that of R.solani. Induces morphological changes in the fungal pathogens F.culmorum, H.sativum and R.solani, but not in A.consortiale and B.cinerea. Has antibacterial activity against the Gram-positive bacterium B.subtilis, but lacks antibacterial activity against the Gram- negative bacterium E.coli.MASS SPECTROMETRY:Mass=3153.6; Method=MALDI; Range=26-55; Source=PubMed:16126239;SIMILARITY:Contains 1 chitin-binding type-1 domain."