PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5930	NO552_SOYBN	--NA--	"Glycine max"	Fabaceae	--NA--	Signaling-peptide	"Glycoprotein; Membrane; Nodulation; Signal | Early nodulin 55-2 precursor (N-55-2) (Nodulin-315).Symbiosome, peribacteroid membrane (Potential)."	--NA--	KVMLTKPGFRHFISGNQSHCQMGLKLAVLVISSNKTKKNLLSPSPSPSPPMASCLPNASPFLVMLAMCLLISTSEAEKYVVGGSEKSWKFPLSKPDSLSHPSSLLSPSPSPLPNNQGVTSSSGAGFIGVMMWLMLLLWANSHRFKIGDTLIFKYEKRTESVHEGNETDYEGCNTVGKYHIVFNGGNT	187	"Experimental evidence at transcript level"	20302.5	20289.24	9.21	--NA--	"DEVELOPMENTAL STAGE:Expressed at early stages of nodule development. Maximal expression is seen in nodules from 14-day-old plants after which levels decrease.INDUCTION:During nodulation in legume roots after Rhizobium infection, and after release of bacteria from the infection thread.SIMILARITY:Contains 1 plastocyanin-like domain."