PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5929	NLTPC_RICCO	--NA--	"Ricinus communis"	Euphorbiaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein C, cotyledon-specific isoform,precursor (NS-LTP C) (Phospholipid transfer protein) (PLTP)."	--NA--	KVGFPVSTNTNCETIHMKNVVFSVLLLLSFLFCLANTNEAAVPCSTVDMKAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLKASSKSLGIKDQFLSKIPAACNI	116	"Experimental evidence at protein level"	12262.43	12254.23	8.92	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.SIMILARITY:Belongs to the plant LTP family."