PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5924	GASA2_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Secreted; Signal | Gibberellin-regulated protein 2 precursor.Secreted."	--NA--	KSSRTKLCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCPMAVFRSTLVLLLIIVCLTTYELHVHAADGAKVGEGVVKIDCGGRCKDRCS	99	"Experimental evidence at transcript level"	10531.44	10524.16	8.98	--NA--	"FUNCTION:Involved in late stages of seed maturation, or in early steps of germination.TISSUE SPECIFICITY:Dry seeds and maturating siliques.PTM:Six disulfide bonds may be present.SIMILARITY:Belongs to the GAST1 family."