PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5912	PRP3_SOYBN	--NA--	"Glycine max"	Fabaceae	--NA--	Signaling-peptide	"Cell wall; Developmental protein; Repeat; Secreted; Signal | Repetitive proline-rich cell wall protein 3 precursor.Secreted, cell wall (Probable)."	--NA--	KPKPPVYKPKPPVYKPPYKKPPYKKPPYGKYPPVEDNTHAMASFVSFLVLLLAALILMPQGLATYYKPIKKPPVYKPPVYKPPVYKPPVY	90	"Protein inferred from homology"	10294.52	10287.76	9.94	--NA--	"SIMILARITY:Belongs to the ENOD12 family."