PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5910	AFP1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Antimicrobial; Complete proteome; Direct protein sequencing; Fungicide; Plant defense; Pyrrolidone carboxylic acid; Secreted; Signal | Cysteine-rich antifungal protein 1 precursor (AFP1) (Anther-specific,protein S18 homolog) (Low-molecular-weight cysteine-rich protein,LCR67).Secreted."	--NA--	KNQCINLEKARHGSCNYVFPAHKCICYFPCMAKSATIVTLFFAALVFFAALEAPMVVEAQKLCERPSGTWSGVCGNSNAC	80	"Experimental evidence at protein level"	8709.22	8703.17	8.49	--NA--	"FUNCTION:Possesses antifungal activity sensitive to inorganic cations.SUBUNIT:Forms oligomers in its native state.TISSUE SPECIFICITY:Expressed predominantly in seeds.SIMILARITY:Belongs to the plant defensin family."