PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5909	AFP1_RAPSA	--NA--	"Raphanus sativus"	Brassicaceae	--NA--	Signaling-peptide	"3D-structure; Antimicrobial; Direct protein sequencing; Fungicide; Plant defense; Pyrrolidone carboxylic acid; Secreted; Signal | Cysteine-rich antifungal protein 1 precursor (AFP1).Secreted."	--NA--	KNQCINLEKARHGSCNYVFPAHKCICYFPCMAKFASIIALLFAALVLFAAFEAPTMVEAQKLCERPSGTWSGVCGNNNAC	80	"Experimental evidence at protein level"	8734.28	8728.2	8.49	--NA--	"FUNCTION:Possesses antifungal activity sensitive to inorganic cations.SUBUNIT:Forms oligomers in its native state.SIMILARITY:Belongs to the plant defensin family."