PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5895	SCRB_ARALY	--NA--	"Arabidopsis lyrata"	Brassicaceae	--NA--	Signaling-peptide	"Self-incompatibility; Signal | S locus cysteine-rich-like protein b precursor."	--NA--	KKDFKNIYRTPIQCKCLDKYDFARLCDCRFCMRNATFFIVFYVFISLVLSNVQDVTAQKNKCMRSEMFPTGPCGNNGEETC	81	"Experimental evidence at transcript level"	9457.05	9450.49	8.68	--NA--	"FUNCTION:Involved in self-incompatibility.TISSUE SPECIFICITY:Expressed in microspores and in young and mature anthers.MISCELLANEOUS:The two genes are located within a perfect direct repeat and probably exhibit identical expression patterns.SIMILARITY:Belongs to the SCRL protein family."