PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5894	2SS2_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Seed storage protein; Signal; Storage protein | 2S seed storage protein 2 precursor (2S albumin storage protein),(NWMU2-2S albumin 2) [Contains: 2S seed storage protein 2 small,subunit; 2S seed storage protein 2 large subunit]."	--NA--	KIQQVGECPFQTTIPFFPPYMANKLFLVCATFALCFLLTNASIYRTVVEFDEDDASNPMGPRQKCQKEFQQCCSELRQEEPVCVCPTLRQAARAVSLQGQHGPFQSRKIYKTAKYLPNICQSQHLRACQKLMRMQMRQGRGGGPSLDDEFDLEDDIENPQGPQQGHQILQ	170	"Experimental evidence at transcript level"	19361.17	19348.41	6.96	--NA--	"FUNCTION:This is a 2S seed storage protein.SUBUNIT:The mature protein consists of a small and a large chain linked by disulfide bonds.SIMILARITY:Belongs to the 2S seed storage albumins family."