PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5891	NEC1_NICPL	--NA--	"Nicotiana plumbaginifolia"	Solanaceae	--NA--	Signaling-peptide	"Apoplast; Direct protein sequencing; Glycoprotein; Manganese; Metal-binding; Oxidoreductase; Secreted; Signal | Nectarin-1 precursor (EC 1.15.1.1) (Superoxide dismutase [Mn]).Secreted, extracellular space, apoplast (By similarity). Note=Secreted in the ne"	--NA--	KGEVFVFPRGLVHFQKNNGKIPAAVVSAFNSQLPGTQSIPITLFGASPTVKVNGFPCKTNFTAADFSSFAISKPGATNNKFGSKVTTANVEQVPGLNTLGMAAFGIKSKIFQIMEMTILFLFAISIDRYCFAADEDMLQDVCVADLHSKVPDDVLAQTFQINIEDVQQIKSKFAPAKKFVSLARIDYAPGGINPPHTHPRASEMVFVMEGELDVGFITTANVLVSKQIT	229	"Experimental evidence at protein level"	24764.62	24748.76	7.88	--NA--	"FUNCTION:May interact with bacterial adhesins thereby protecting the reproductive tissues from microbial attack. Has no oxalate oxidase activity (By similarity).CATALYTIC ACTIVITY:2 superoxide 2 H() = O(2) H(2)O(2).COFACTOR:Binds 1 manganese ion per monomer (By similarity).BIOPHYSICOCHEMICAL PROPERTIES:Temperature dependence: Highly thermostable;SUBUNIT:Monomer. In the absence of manganese, it forms tetrameric and pentameric forms which show superoxide dismutase activity (By similarity).PTM:Glycosylated (By similarity).SIMILARITY:Belongs to the germin family."