PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5890	NEC1_NICLS	--NA--	"Nicotiana langsdorffii x Nicotiana sanderae"	Solanaceae	--NA--	Signaling-peptide	"Apoplast; Direct protein sequencing; Glycoprotein; Manganese; Metal-binding; Oxidoreductase; Secreted; Signal | Nectarin-1 precursor (EC 1.15.1.1) (Superoxide dismutase [Mn]).Secreted, extracellular space, apoplast."	--NA--	KGEVFVFPRGLVHFQKNNGEVPAAVISAFNSQLPGTQSIPITLFGASPPVKVNGFPCKTNFTAADFSSLAISKPGATNNKFGSVVTTANVEQVPGLNTLGMAAFGINSKIFQSMEMAILFLLAISIDRYCFAADEDMLQDVCVADLHSKVPDDVLAQTFQINTEDVQQIKSKFAPVKKFVSLARIDYAPGGINPPHTHPRASEMVFVMEGELDVGFITTANVLVSKKII	229	"Experimental evidence at protein level"	24622.41	24606.67	6.09	--NA--	"FUNCTION:May interact with bacterial adhesins thereby protecting the reproductive tissues from microbial attack. Has no oxalate oxidase activity.CATALYTIC ACTIVITY:2 superoxide 2 H() = O(2) H(2)O(2).COFACTOR:Binds 1 manganese ion per monomer.SUBUNIT:Monomer. In the absence of manganese, it forms tetrameric and pentameric forms which show superoxide dismutase activity.Note=Found in the nectar.TISSUE SPECIFICITY:Nectary tissues and to a lower level ovary.Not detected in petals, stems, leaves, roots or other floral tissues.DEVELOPMENTAL STAGE:Expressed during nectar secretion, while the flowers remain open.MASS SPECTROMETRY:Mass=22533; Mass_error=58; Method=MALDI; Range=33-229; Source=PubMed:10952990;SIMILARITY:Belongs to the germin family."