PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5889	FKB21_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Endoplasmic reticulum; Isomerase; Rotamase; Signal | FK506-binding protein 2-1 precursor (EC 5.2.1.8) (Peptidyl-prolyl cis-,trans isomerase) (PPIase) (Rotamase) (15 kDa FKBP) (FKBP-15-1).Endoplasmic reticulum lumen (Potential)."	--NA--	KGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGTGQVIPGWDQGLLGACMMSSASAMKAVGFLLLLTILTLAYAKKSGDVTELQIGVKYKPQKCDLQAHNELVGEKRKLKIPSKLGYGDNGSPPKIPGGATLIFDTELVAVNGEPSSEAKSK	153	"Experimental evidence at transcript level"	16354.86	16344.56	8.49	--NA--	"FUNCTION:PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.CATALYTIC ACTIVITY:Peptidylproline (omega=180) = peptidylproline (omega=0).SIMILARITY:Belongs to the FKBP-type PPIase family. FKBP2 subfamily.SIMILARITY:Contains 1 PPIase FKBP-type domain."