PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5867	CY550_ODOSI	--NA--	"Odontella sinensis"	Eupodiscaceae	--NA--	Signaling-peptide	"Chloroplast; Electron transport; Heme; Iron; Membrane; Metal-binding; Photosynthesis; Photosystem II; Plastid; Signal; Thylakoid; Transport | Cytochrome c-550 precursor (Cytochrome c550).Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Lumenal si"	--NA--	IVTEKWGGGKIYYMFKKSYQFFALVLFSIFNVLVTSASAIDLDEATRTVVADSNGNTTVLTPEQVKRGKRLFNNTCGACHVGGVTKTNPNVGLRPEGLSLATPRRDNAAALVDYLKNPTSYDGLESIAEIHPSIKSGDIYPRMRSLTDEDLFSIAGHILLQPK	163	"Protein inferred from homology"	17838.37	17827.24	8.56	--NA--	"FUNCTION:Low-potential cytochrome c that plays a role in the oxygen-evolving complex of photosystem II (By similarity).COFACTOR:Binds 1 heme group covalently per subunit (By similarity).SUBUNIT:The oxygen-evolving complex may be composed of psbO, psbQ', psbV and psbU (Potential).SIMILARITY:Belongs to the cytochrome c family. PsbV subfamily."