PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5847	VIOLA_VIOOD	--NA--	"Viola odorata"	Violaceae	--NA--	Signaling-peptide	"3D-structure; Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Plant defense; Signal | Violacin-A precursor (Violacin-1)."	--NA--	IPVMAKTIISNPVLEEGMLTYYTNKKLGDSAISCGETCFKFKCYTPRCSCMDAQKMKMVIGLVLVATTAFALMIPAASAVDDFITRRAYDNLVKSGAIKDSYPVCK	106	"Experimental evidence at protein level"	11588.76	11580.82	8.77	--NA--	"FUNCTION:Probably participates in a plant defense mechanism. Has low hemolytic activity.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.PTM:Violacin-A is not a cyclic peptide.MASS SPECTROMETRY:Mass=3004.9; Method=MALDI; Range=80-106; Source=PubMed:16488428;MASS SPECTROMETRY:Mass=3004.3; Method=MALDI; Range=80-106; Source=PubMed:16872274;MISCELLANEOUS:The presence of a premature stop codon inhibits the translation of a key Asn residue that is thought to be required for cyclization.SIMILARITY:Belongs to the cyclotide family. Moebius subfamily."