PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5846	API7_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Aspartic protease inhibitor; Glycoprotein; Protease inhibitor; Serine protease inhibitor; Signal; Vacuole | Aspartic protease inhibitor 7 precursor (Cathepsin D inhibitor p749).Vacuole (By similarity)."	--NA--	IPLSGANIFEDQLLNIQFNIPTVKLCGSYTIWKVGNINAHLRTMLLETGGMMKCLFLLCLCLFPILVFSSTFTSQNPINLPSESPVPKRVLDTNGKKLNPNGKRRLALVNENPLDVLFQEVNSSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFTIGQADSSYFKIVKSSKFGYNLLYCPLTRHFLCPFCRDDNFCAKVGVVIQ	221	"Experimental evidence at transcript level"	24485.42	24469.52	8.86	--NA--	"FUNCTION:Inhibitor of cathepsin D (aspartic protease). May also inhibit trypsin and chymotrypsin (serine proteases). Protects the plant by inhibiting proteases of invading organisms.TISSUE SPECIFICITY:Tubers, leaves.INDUCTION:By wounding. Also expressed in upper non-wounded systemic leaves.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family."