PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5828	NO12_MEDTR	--NA--	"Medicago truncatula"	Fabaceae	--NA--	Signaling-peptide	"Cell wall; Nodulation; Repeat; Secreted; Signal | Early nodulin 12 precursor (N-12).Secreted, cell wall (Potential)."	--NA--	IHFMASFSLSILVFFFSALVLVPQGFAEYYLYPAYRPPQTKPPVNKPSHKEPPVNKPPHKEPPVHKPPHKDPPVNKPPQKESPVHKPPRKESPTHRHPPAEDN	103	"Experimental evidence at transcript level"	11743.55	11736.17	9.7	--NA--	"FUNCTION:Involved in the infection process during the plant- rhizobium interaction.TISSUE SPECIFICITY:Root nodules.INDUCTION:By soluble compounds from rhizobium (in cells through which the infection thread is migrating and also in cells that do not yet contain an infection thread).SIMILARITY:Belongs to the ENOD12 family."