PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5827	ICID_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Protease inhibitor; Serine protease inhibitor; Signal | Wound-induced proteinase inhibitor 1 precursor (Wound-induced,proteinase inhibitor I) (Chymotrypsin inhibitor I, D subunit)."	--NA--	IGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVMESKFAHIIVFFLLATSFETLLARKESDGPEVIELQKEFECNGKQRWPELVQIPRVA	107	"Experimental evidence at protein level"	12145.17	12137.46	5.85	--NA--	"FUNCTION:Inhibits both chymotrypsin and trypsin.SUBUNIT:Heterogeneous tetramers of similar chains.MISCELLANEOUS:Mechanical damage (i.e., insect chewing) to this plant results in the systemic release of a factor from the wound site. Within the leaves it induces the cytoplasmic synthesis of proteinase inhibitors I and II.SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family."