PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5826	ICI1_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Serine protease inhibitor; Signal | Proteinase inhibitor 1 precursor (Proteinase inhibitor I)."	--NA--	IGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDIRCDRVRLFDNILGYVMELKFAHIIVFFLLATSFETLMARKESDGPEVIQLLKEFQCKGKLRWPELVDIPVVG	107	"Protein inferred from homology"	12063.33	12055.59	6.93	--NA--	"SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family."