PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5821	API1_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Aspartic protease inhibitor; Direct protein sequencing; Glycoprotein; Protease inhibitor; Serine protease inhibitor; Signal; Vacuole | Aspartic protease inhibitor 1 precursor (pA1) (gCDI-A1) (STPIA),(STPID).Vacuole (By similarity)."	--NA--	IGKADSSYFKIVKSSKFGYNLLYCPITRPPIVCPFCRDDDFCAKVGVVIQIPLSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNTHLWTMLLETGGTMMKCLFFLCLCLFPILVFSSTFTSQNPINLPSESPVPKPVLDTNGKKLNPNGKRRLALVNENPLDVLFQEVNSSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRF	221	"Experimental evidence at protein level"	24545.55	24529.54	8.56	--NA--	"FUNCTION:Inhibitor of cathepsin D (aspartic protease). May also inhibit trypsin and chymotrypsin (serine proteases). Protects the plant by inhibiting proteases of invading organisms.TISSUE SPECIFICITY:Tubers, young leaves and flower bud. Not detected in root, stem or mature leaves.INDUCTION:By methyl jasmonate and wounding; but not by sucrose.MISCELLANEOUS:Has a single chain structure.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family."