PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5820	RNS2_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Endonuclease; Glycoprotein; Hydrolase; Nuclease; Secreted; Signal | Ribonuclease S-2 precursor (EC 3.1.27.1) (Stylar glycoprotein 2) (S2-,RNase).Secreted, extracellular space."	--NA--	IGIRDQPLWKDQYKKHGTCCLPRYNQLQYFLLAMRLKEKFDLLTTLRTHGITPGTKHTFKKIQDAIKTVTQEVPDLKCVENIQGVLELYEIGICFTPEADMAKSQLVSALFVFFFSLSPIYGDFDYMQLVLTWPRSFCYPRGFCNRIPPNNFTIHGLWPDKKPMRGQLQFCTSDDYIKFTPGSVLDALDHHWIQLKFERESLFPCRQSKSCHPTENPLILFRL	223	"Experimental evidence at transcript level"	26075.35	26058.29	8.69	--NA--	"FUNCTION:Self-incompatibility (SI) is the inherited ability of a flowering plant to prevent self-fertilization by discriminating between self and non-self pollen during pollination. In many species of the Solanaceae, self-incompatibility is controlled by the single, multiallelic locus S. This stylar glycoprotein is associated with expression of self-incompatibility in potato.CATALYTIC ACTIVITY:Two-stage endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides with 2',3'-cyclic phosphate intermediates.TISSUE SPECIFICITY:Pistil.SIMILARITY:Belongs to the RNase T2 family.CAUTION:Gln-112 is present instead of the conserved Glu which is expected to act as an active site proton donor."
