PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5819	Y4141_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Signal | Uncharacterized protein At4g14100 precursor."	--NA--	IFYTGREAHIMTYEVGAVLEDEKWQAPVYCFNKEKKSLSTKGALSEFKGYKEKAALLEVGILRPNWLDGAKYLGQQNVSGFLCNVWEKVDFIWYYEDVETKRPVQWMAFRRPLIVIVIFIYITAGVKIAAADEPVPTPWPHQFHALMFMNYSGDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEWNNGTSFFYTLDESKSCRSGQ	206	"Experimental evidence at transcript level"	23930.32	23914.9	5.28	--NA--	"SEQUENCE CAUTION:Sequence=CAB10188.1; Type=Erroneous gene model prediction; Note=The predicted gene At4g14090 has been split into 3 genes: At4g14096, At4g14100 and At4g14103; Sequence=CAB78451.1; Type=Erroneous gene model prediction; Note=The predicted gene At4g14090 has been split into 3 genes: At4g14096, At4g14100 and At4g14103; "