PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5803	IP2T_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Repeat; Serine protease inhibitor; Signal | Proteinase inhibitor type-2 T precursor (Proteinase inhibitor type II,T)."	--NA--	ICINCCSGYKGCNYYSAFGDLICQGESDPKNPKACPLNCDTNIAYSRCPRMAVHKEVSFVAYLLIVLGMFLYVDALGCTKECGNLGFGICPRSEGSPTNPSEGKSLIYPTGCTTCCTGYKGCYYFGTNGKFVCEGESDEPKPYMSTA	147	"Experimental evidence at transcript level"	15860.16	15849.17	5.8	--NA--	"FUNCTION:Inhibitor of trypsin and chymotrypsin.INDUCTION:Not induced by wounding.SIMILARITY:Belongs to the protease inhibitor I20 (potato type II proteinase inhibitor) family."