PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5802	IP21_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"3D-structure; Protease inhibitor; Repeat; Secreted; Serine protease inhibitor; Signal | Wound-induced proteinase inhibitor 2 precursor (Wound-induced,proteinase inhibitor II).Secreted."	--NA--	ICINCCSGYKGCNYYNSFGKFICEGESDPKRPNACTFNCDPNIAYSRCPRMAVHKEVNFVAYLLIVLGMFLYVDAKACTRECGNLGFGICPRSEGSPLNPSQGKSLIYPTGCTTCCTGYKGCYYFGKDGKFVCEGESDEPKANMYPVM	148	"Experimental evidence at protein level"	16292.75	16281.4	7.89	--NA--	"FUNCTION:Potent inhibitor of both trypsin and chymotrypsin.INDUCTION:Mechanical damage (i.e., insect chewing) to this plant results in the systemic release of a factor from the wound site.Within the leaves it induces the cytoplasmic synthesis of proteinase inhibitors I and II.SIMILARITY:Belongs to the protease inhibitor I20 (potato type II proteinase inhibitor) family."