PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5801	IAAE_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Trypsin inhibitor CMe precursor (Chloroform/methanol-soluble protein,CMe) (Alpha-amylase/trypsin inhibitor) (BTI-CMe1) (BTI-CMe2.1) (BTI-,CMe3.1).Secreted."	--NA--	ICHQGPRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAMAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPELQPGYGVVL	148	"Experimental evidence at protein level"	16135.67	16124.89	7.66	--NA--	"FUNCTION:Inhibits trypsin in vitro. Probably plays a protective role through inhibition of insect midgut proteases.TISSUE SPECIFICITY:Expressed in the developing endosperm. Not detected in embryo, aleurone, coleoptile, roots and leaves.PTM:Five disulfide bonds are present (Probable), which are essential for the inhibitor activity.MISCELLANEOUS:The sequence heterogeneity suggests that more than one gene exists for this inhibitor. The genes may be alleles, or multiple loci could exist.SIMILARITY:Belongs to the protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family.SEQUENCE CAUTION:Sequence=CAA35188.1; Type=Erroneous termination; Positions=145; Note=Translated as Gly; "