PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5793	NO3_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Metal-binding; Nodulation; Signal | Nodulin 3 precursor (N-3)."	--NA--	HYMCIDKECVLFREVLQTPMAKILKFVFAIILFFSLFLLSMEAEPLLPCETDGDCPLKPIIETTPMISL	69	"Experimental evidence at transcript level"	7908.6	7903.07	4.64	--NA--	"DEVELOPMENTAL STAGE:Expressed in the second stage of root nodule formation.MISCELLANEOUS:Contains 4 cysteines arranged in two pairs in such a way that they might be capable of binding a metal ion."