PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5787	EXTN3_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Hydroxylation; Repeat; Secreted; Signal; Structural protein | Extensin-3 precursor (AtExt3) (AtExt5).Secreted, primary cell wall."	--NA--	HSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSMASLVATLLVLTISLTFVSQSTANYFYSSPPPPVKHYTPPVKHYSPPPVYPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPPPPPPVHHYSPPHHPYLYKSPPPPYHYPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP	427	"Experimental evidence at protein level"	48803.77	48772.56	9.91	--NA--	"FUNCTION:Structural component which strengthens the primary cell wall.TISSUE SPECIFICITY:Predominantly expressed in the roots.DEVELOPMENTAL STAGE:Early expressed in the whole plant, but was restricted to lower stems, flower buds and roots in the mature plant (6 weeks old).INDUCTION:By wounding, water and cold stresses; in response to plant hormones 2,4-D, BAP, GA3, and ABA treatment; in response to L-Ser, Hyp and L-Pro treatment. Slightly repressed by salt stress.PTM:Extensins contain a characteristic repeat of the pentapeptide Ser-Pro(4). For this particular extensin, a typical repeat of Ser- Pro(3) is found. In both cases, the proline residues are hydroxylated and then O-glycosylated (arabinosylation).PTM:Synthetised as soluble proteins which become insolubilised in the cell wall through the intermolecular cross-linking of Tyr on adjacent monomers. Isodityrosine (IDT) stabilizes and makes rigid the part of the polypeptide where IDT functional sites are present.SIMILARITY:Belongs to the extensin family.SEQUENCE CAUTION:Sequence=BAB20084.1; Type=Miscellaneous discrepancy; Note=Chimeric cDNA. Its C-terminal part is derived from the gene At2g20230; Sequence=BAB20086.1; Type=Miscellaneous discrepancy; Note=Truncated cDNA resulting of the removal of two cryptic introns in the genomic sequence; "