PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5776	PSK4_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Developmental protein; Differentiation; Growth factor; Secreted; Signal; Sulfation | Putative phytosulfokines 4 precursor (AtPSK4) [Contains:,Phytosulfokine-alpha-like (PSK-alpha-like) (Phytosulfokine-a-like);,Phytosulfokine-beta (PSK-beta) (Phytosulfokine-b)].Secreted (By similarity)."	--NA--	HEVAGESCDKEDDEDCLVRRTLTAHLDYIYTHKNNHHMANLSTLITIALLLCATMLTCSARPEPAYFASFTTSPADTLSLEMIESKL	87	"Protein inferred from homology"	9701	9694.66	4.94	--NA--	"FUNCTION:Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation (By similarity).PTM:Sulfation is important for activity and for the binding to a putative membrane receptor (By similarity).SIMILARITY:Belongs to the phytosulfokine family.CAUTION:This potential protein encodes for a PSK precursor that would produce a PSK-alpha that differs in the last residue (His) from a normal PSK-alpha (Gln). Furthermore there are no ESTs or cDNAs so far for this potential gene."