PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5773	DR39_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Antimicrobial; Fungicide; Pathogenesis-related protein; Plant defense; Signal | Disease resistance response protein 39 precursor."	--NA--	HCKNKAHLISGTCHDWKCFCTQNCMEKKSLAALSFLLLLVLFVAQEIVVTEANTCEHLADTYRGVCFTNASCDD	74	"Experimental evidence at transcript level"	8254.54	8248.9	6.03	--NA--	"FUNCTION:Possesses antifungal activity (By similarity).TISSUE SPECIFICITY:Pods.INDUCTION:Upon contact with the plant pathogen fungus Fusarium solani.SIMILARITY:Belongs to the plant defensin family."