PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5771	EXPB1_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"3D-structure; Allergen; Cell wall; Cell wall biogenesis/degradation; Direct protein sequencing; Glycoprotein; Membrane; Secreted; Signal | Expansin-B1 precursor (ZmEXPB1) (Beta-expansin-1a) (Pollen allergen,Zea m 1) (Zea m 1d).Secreted, cell wall; Peripheral membrane protein (By similarity)."	--NA--	HCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDMGSLANNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRVIPANWRPDAVYTSNVQFYYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEV	269	"Experimental evidence at protein level"	29084.63	29065.57	8.99	--NA--	"FUNCTION:May aid fertilization by loosening the cell wall of the stigma and style, thereby facilitating penetration of the pollen tube. Acts selectively on grass cell walls, which are relatively poor in pectins and xyloglucans and rich in glucuronoarabinoxylans and (1-3),(1-4)-beta-D-glucans, when compared with cell walls of other angiosperms, including other monocots.TISSUE SPECIFICITY:Expressed in anthers and pollen.DEVELOPMENTAL STAGE:Expression low before and high after pollen mitosis.ALLERGEN:Causes an allergic reaction in human. Causes maize pollen allergy.MISCELLANEOUS:Beta-expansin 1 extension activity grass cell wall is enhanced by dithiothreitol (DTT) and EDTA, inhibited by Cu(2) and Hg(2), and resitant to denaturation by methanol boiling and heat treatments.SIMILARITY:Belongs to the expansin family. Expansin B subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain. "