PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5762	NLTP1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Cell wall; Cell wall biogenesis/degradation; Complete proteome; Lipid-binding; Secreted; Signal; Transport | Non-specific lipid-transfer protein 1 precursor (LTP 1).Secreted, cell wall."	--NA--	GVNIPYKISTSTNCKTVRMAGVMKLACLLLACMIVAGPITSNAALSCGSVNSNLAACIGYVLQGGVIPPACCSGVKNLNSIAKTTPDRQQACNCIQGAARALGSGLNAGRAAGIPKAC	118	"Experimental evidence at transcript level"	11754.89	11746.95	9.3	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:Expressed primarily in epidermal cells.SIMILARITY:Belongs to the plant LTP family."