PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5755	RAG2_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Allergen; Secreted; Signal | Seed allergenic protein RAG2 precursor (Seed allergenic protein RA14).Secreted (Probable)."	--NA--	GVCYWLGYPRTPRTGHMASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH	166	"Experimental evidence at protein level"	17864.56	17852.67	8.11	--NA--	"PTM:Five disulfide bonds are present (By similarity).ALLERGEN:Causes an allergic reaction in human.SIMILARITY:Belongs to the cereal trypsin/alpha-amylase inhibitor family.SEQUENCE CAUTION:Sequence=BAA07710.1; Type=Frameshift; Positions=65, 74; "