PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5750	CPI9_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Signal; Thiol protease inhibitor; Vacuole | Cysteine protease inhibitor 9 precursor (PKIX) (pT1).Vacuole (By similarity)."	--NA--	GTPVVFVRKSESDYGDVVRVMTGVYIKFFVKTTKLCVDQTVWKVNHEGLVGYPRLVTVDDDKDFLPFVFIKAMKSINILSFLLLSSTLSLVAFARSFSSENPIVLPSTCHDDDNLVLPEVYDQDGHPLRIGQRYIINNPLIGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEVTGGQVGNENDIFKIRKTDLVTPEGSKFVYKLLHCPSHLQCKNIGGNFKN	222	"Experimental evidence at transcript level"	24738.57	24722.8	7.15	--NA--	"FUNCTION:Putative inhibitor of cysteine proteases. Does not inhibit papain. May protect the plant by inhibiting proteases of invading organisms.TISSUE SPECIFICITY:Tuber.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.CAUTION:Ref.1 postulates an inhibition of trypsin but the sequence homology points to a cysteine protease inhibitor."