PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5738	IP27_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Repeat; Serine protease inhibitor; Signal | Proteinase inhibitor type-2 CM7 precursor (Proteinase inhibitor type,II CM7)."	--NA--	GSPKNPICINCCSGYKGCNYYSVFGRFICEGESDLKNPKACPLNCDTNIAMDVHKEVNFVAYLLIVLGIFLLVSVVEHVDAKICTKECGNLGFGICPRSEYPAMYSRCPHSEGKSLIYPTGCTTCCTGYKGCYYFGKNGKFVCEGESDEPKANM	154	"Protein inferred from homology"	16868.48	16856.85	6.91	--NA--	"SIMILARITY:Belongs to the protease inhibitor I20 (potato type II proteinase inhibitor) family."