PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5737	IP25_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Repeat; Serine protease inhibitor; Signal | Proteinase inhibitor type-2 P303.51 precursor (Proteinase inhibitor,type II P303.51)."	--NA--	GSPENRICTNCCAGYKGCNYYSANGAFICEGESDPKKPKACPRNCDPHIAMAVHKEVNFVAYLLIVLGLLVLVSAMEHVDAKACTLECGNLGFGICPRSEYPAMYSKCPRSEGKSLIYPTGCTTCCTGYKGCYYFGKNGKFVCEGESDEPKANM	154	"Experimental evidence at transcript level"	16660.2	16648.68	7.52	--NA--	"SIMILARITY:Belongs to the protease inhibitor I20 (potato type II proteinase inhibitor) family."