PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5729	GRP2_ORYSI	--NA--	"Oryza sativa subsp. Indica"	Poaceae	--NA--	Signaling-peptide	"Cell wall; Cell wall biogenesis/degradation; Repeat; Secreted; Signal; Structural protein | Glycine-rich cell wall structural protein 2 precursor (Glycine-rich,protein 1) (GRP-1).Secreted, cell wall (Potential)."	--NA--	GSGGGGGGGGGQGGGSGSGSGSGYGSGSGGGNGHHMATTKHLALAILVLLSIGMTTSARTLLGYGPGGGGGGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAGGGYGRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYGSGGGGGGGQGGGAGGYGQGSGYGSGYGSGAGGAHGGGY	185	"Experimental evidence at transcript level"	14882.13	14873.39	7.09	--NA--	"FUNCTION:Responsible for plasticity of the cell wall (Potential).INDUCTION:By infection with rice yellow stunt virus."