PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5725	PER27_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Calcium; Complete proteome; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Secreted; Signal | Peroxidase 27 precursor (EC 1.11.1.7) (Atperox P27) (PRXR7) (ATP12a).Secreted (By similarity)."	--NA--	GRTGVLTGKAGEIRKTCRSANIIDDSKAALEKVCPGIVSCSDILALVARDAMVALEGPSWEVETGRRDGRVMAASKRLVVSCLFLVLLFAQANSQGLKVGFYSKTCPQLEGIVKKVVFDAMNKAPTLGAPLLRMFFHDCFVRGCDGSVLLDKPNNQGEKSAVPNLSLRGFGNRLYNFTGKGDSDPSLDSEYAAKLRKKCKPTDTTTALEMDPGSFKTFDLSSNINEVNLPSPFDNITKLISDFRSKGLNEKDLVILSGGHTIGMGHCPLLTYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQIRTHGSMFFNDFGVSMVKM	321	"Experimental evidence at protein level"	34950.4	34927.95	9.16	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit (By similarity).COFACTOR:Binds 2 calcium ions per subunit (By similarity).TISSUE SPECIFICITY:Expressed in the whole plant, but preferentially in roots and flowers.INDUCTION:Up-regulated transiently by a cold treatment.MISCELLANEOUS:There are 73 peroxidase genes in A.thaliana.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily."