PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5717	API10_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Aspartic protease inhibitor; Glycoprotein; Protease inhibitor; Serine protease inhibitor; Signal; Stress response | Aspartic protease inhibitor 10 precursor (Wound-induced aspartate,proteinase CDI inhibitor)."	--NA--	GQADSSYFKIVKSSILGYNLLYCPITRPILCPFCRDDDFCAKVGVVIQKGIPLSGGIFEDQLLNIQFNIPTVRLCVSYTIWKVGINAYLRTMLLETGGTIKRRLALVNENPLDVNFKEVMMKCLFLLCLCLVPIVVFSSTFTSQNLIDLPSESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRF	219	"Experimental evidence at transcript level"	24035.05	24019.44	8.36	--NA--	"FUNCTION:Inhibitor of cathepsin D (aspartic protease) and trypsin (serine protease). Protects the plant by inhibiting proteases of invading organisms.TISSUE SPECIFICITY:In tubers and green buds of untreated plants.After abscisic acid treatment or mechanical wounding is mostly accumulated in leaves, to a lesser extent in stems, but not in roots.INDUCTION:By abscisic acid (ABA), jasmonic acid (JA) and wounding.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family."