PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5673	NLTP_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"3D-structure; Allergen; Alternative splicing; Direct protein sequencing; Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein precursor (LTP) (Phospholipid,transfer protein) (PLTP) (Allergen Zea m 14)."	--NA--	GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVNMARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS	120	"Experimental evidence at protein level"	11705.32	11697.81	9.12	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Comment=Additional isoforms seem to exist; Name=1; IsoId=P19656-1; Sequence=Displayed; Name=2; Synonyms=long; IsoId=P19656-2; Sequence=VSP_003147;ALLERGEN:Causes an allergic reaction in human.SIMILARITY:Belongs to the plant LTP family."