PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5671	PRP1_MEDTR	--NA--	"Medicago truncatula"	Fabaceae	--NA--	Signaling-peptide	"Cell wall; Developmental protein; Repeat; Secreted; Signal | Repetitive proline-rich cell wall protein 1 precursor.Secreted, cell wall (Probable)."	--NA--	GPPHHPKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYMASSNFLVLLLFALFAIPQGLANYEKPPVYQPPVYKPPVEKPPVYKPPVE	206	"Experimental evidence at transcript level"	23336.36	23321.21	9.87	--NA--	"FUNCTION:This is a developmentally regulated putative cell wall protein (By similarity).TISSUE SPECIFICITY:Expressed in hypocotyls, roots and mature root nodules.SIMILARITY:Belongs to the ENOD12 family."