PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5648	BABL_LILLO	--NA--	"Lilium longiflorum"	Liliaceae	--NA--	Signaling-peptide	"Copper; Direct protein sequencing; Metal-binding; Signal | Chemocyanin precursor (Basic blue protein) (Plantacyanin)."	--NA--	GKTFRAGDVLVFKYNPAVHNVVSVPAGGYKSCTASPGSRVFKSGDDRITLMAQGSGSAERALVLGVVLVFLVFNCEVAESVVYTVGDGGGWTFGTSGWPASRGTNYFICSVPGHCQGGLKIAVTAA	126	"Experimental evidence at protein level"	12978.79	12970.52	8.79	--NA--	"FUNCTION:Diffusible chemotropic factor that induces pollen tube chemotropism.TISSUE SPECIFICITY:Strongly expressed in stigma and style and to a lesser extent in leaves, ovary and petals. Not detected in pollen tubes, mature anthers or roots.INDUCTION:Activity enhanced in the presence of stigma/stylar Cys- rich adhesin (SCA).MASS SPECTROMETRY:Mass=9898.0; Method=Electrospray; Range=31-126; Source=PubMed:14671326;SIMILARITY:Contains 1 plastocyanin-like domain."