PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5644	SPI7_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Allergen; Direct protein sequencing; Protease inhibitor; Serine protease inhibitor; Signal; Vacuole | Serine protease inhibitor 7 precursor (PIG) (PIGEN1) (Allergen Sola t,4) (STPIB) (STPIA) (pKEN14-28) (pF4).Vacuole."	--NA--	GKRRLALVKDNPLDVSFKQVQIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNMKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGT	221	"Experimental evidence at protein level"	24027.56	24012.06	7.67	--NA--	"FUNCTION:Inhibitor of trypsin (serine protease). May protect the plant by inhibiting proteases of invading organisms (By similarity).TISSUE SPECIFICITY:Tubers. Not detected in root, stem, leaves or flower bud.INDUCTION:Not induced by sucrose, methyl jasmonate or wounding.ALLERGEN:Causes an allergic reaction in human.MISCELLANEOUS:Has a single chain structure.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.CAUTION:Was originally (Ref.1 and Ref.2) thought to be an aspartic proteinase inhibitor."